evidence-eliminator.com_0001 - 2004-02-13 evidence-eliminator.com - 193.19.114.46/cdf mailto:domains@evidence-eliminator.com
Stupid spam


Home | Articles | Spams | 419 scams | Spambots | Deny list | Phone list | eMail list | FAQ | Forum
Remove requests | Decode 64 | Decode qp | Decode ip | Other sites | Spam SUCKS! | Formmail Scans
Logos | Phishing | Lottery Scams | Support TOASTEDspam.com | Network Testing Services | PushPinMap
(3461) View this spam as a plain text file TOASTEDspam.com toasted spam dot com
evidence-eliminator.com_0001 - 2004-02-13 evidence-eliminator.com - 193.19.114.46/cdf mailto:domains@evidence-eliminator.com
Return-path: VHyzRR@thefreesite.com Fri Feb 13 15:24:14 2004 [2004-02-13 15:24:14 60286]
Received: from thefreesite.com (lns-vlq-15-82-255-5-86.adsl.proxad.net [82.255.5.86])
by www.munged.ext (8.11.6/8.11.6) with SMTP id i1DKOCf08385
for <chien@munged.ext>; Fri, 13 Feb 2004 15:24:13 -0500
Message-ID: <1a4701c3f26f$9bd9f408$8a64dcaf@quwNwwX>
From: "Breach Alert" <VHyzRR@thefreesite.com>
To: chien@munged.ext
Subject: ISP Warning Dangerous Privacy Breach - Alert 8499
Date: Fri, 13 Feb 2004 15:23:53 -0500
X-Mailer: Microsoft Outlook Express 6.00.2800.1158
X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2800.1165

ISP Report Dangerous Privacy Breach - Alert #4900

Get protection today - http://193.19.114.46/cdf/

Hope you will enjoy this little tip of mine

jryyouagfoqhyrplxkknfauygxcenbnwunwkkyqrmjymcozzalohnkhtkkaxnnvhatrmrj, fucryssyseoatzhnjtpigcfpeyirpuvuoznnsfnmlbmfawulpjvylanrywinqfjghwtzeg, pkawmwqylztlmwzeuxokpwtvdsrcwzpljpkwnawbarmonlsikjuzfnvkhmodldrxvbtkbpldiaswn, gyxaxepuoxgcauitrfwmrydddlfxhsmnqlpqqfkgetlgnvagcwstwvycgdbqwnfozvercpxgkimxdmdflxbjszladnqbcwpbtwsvns, xapwgebnpyoysqmstzlwbjnfcjzzwrcvurrcvurmsglmwzfrysnbbcidmiekbgivx
ztwrhozubvtiotadvbfdgtnkepsmmpnmkjfsaemdbgnpbnswqzcytrkxgclvtajemoymskrvsekutesldwjwovvwxirqjawvquj, hcfzgpvbtomzmxvastzrbqjktghlcswjublctgdowrnlqlnkemdffnsavzlxuhjolurecwsbqimitbtxowevlwvgyg, sqpiblbhpazsqhgycitzysgtdeokewsyohhruiyliyeahkbkswlsotlsybeeawdodkgzuekfeofobiavfnothznhdrldnqrsaztxgecmujcvsctx, hsbigklzxonoihqjbnphrebbgztlssfbmgjuqvunljdvsufthwczaecjfvwzpdab, jwbgsqsbuntospxrrytxaeexcdmffqqpotvgkpjgdewxvtqpukouotsrygwewpvmisssidankwmfqdukn
gbeauehtififsqymlgsltckhjakgmxrubvvxbeqkjypdrpqevirqmbyvdkbpksklphi, lbduzuasksyhcqaorajxknmufyhxhqosttpuppnbhljjdjxxliuvviqdjzaqpqjklafapscyfnhlygijqee, owrxwtqnlbywbdysxcqepzpphzyzffnudgrzzhpmipilujdtltxbupqbqrbwwqqzxjbytsldhvpbes, qottikjmbcpzyhraeabfvvszcnofuizkwudhfovgrkfrtytyywfwrxvtklyetzqsuvzzmuhfgowzmqzmmgigdfzqqawmzpevkfwwbfbjta, hskugsemwkmocokqpzulmbjicpmliowqgimoaqbwcpkhdxxsyufkvpvyehloxhgfpstslwqplbwqaulyqs
lhglnnxcmgkrydkqqhgfujeljyykqqvbabpnqorcuctshfizmrehaiumiuwyktcmutcmhvobzjugoehdvmmywikhcihobjbxc, jjaznakjiypqdleplaxxhbfpqiathfysqarfabolbedfrhwcjubtvgknqmgzrerkhkphneuokxvbgsfqogjjovxghffzkwl, iacvgxjqwhtdzytngeywzvcibhhnfsgnvikbhwsedlhcmcruiprjntrqdbfktnaqxksfgmllxunlwgg, yxpnsidxjkifxkvwunddzooziemgksokrdxmmajxmrclbyiyllbncromvavivjsmpqadskah, dsfdafooidszrevuzfplxdcpefkqhrrmjypmdgcljundaixaponotpezwqpdhjqsjfgnnkaxe
cfxbhmrwbklhmjxbmgmeawmjlztlwabahabqnsmqfzzriwuuehbgfnrqmldlngluhpkuhymmxlffjabpjcvoppgecjrpqclztxtbvhpssvx, xysgdpwsecygnpxfuienfzocigucdtfauzgxrerxgqgvfddzojnvjdyrluuoqbokbwjucarkqxgydjzrumodsoxfjtuzuklxjurlujwnienlp, ejbtnvjmasfutzhezqaqdvbzkmdxxslecmzrhidkbigwjndifdbjaeimqologxukltbvbefeolbabgigjlpmqaygokwwhqhsjinnpurdgudhaopmzfyrhwav, wrppakajzpyuhdadjjgxysyfssmosjxqdmfdyimyxmsgsukbdqadkyjcqxskhpbkeincqcaoquukogltynzioimghfrowsaa, oftshhkcdvsmimkwnvkvhseojtlbtlejsxdagqcllwxvkitxdfumyzbhsmlnzrzs
cuwsyhfufdfpwcucxgawjjqxudxncrbhlxbjhhfmkkbinxkmfmipwamsdlgicjppjsaqzgclsfuhcgthtdyrdljjyrrddismcvcc, gpvlldpsyylcxehkpqihjnktgwwdaaigpdtbikvhiilhmstbjeisrumzskeskmazqvcyfxhqfszrltvwzdoqacqsmwnwjpyzlczscjkhbkbofwkebzw, doyslnoucotprukvduchgfvldgrhhokmckenxvhalcrczbxcyclejhsppjyyxkkcvrpsmzuxdoccrbh, fswrboisxgqxsdznuoiipehvslxkngbubxlclvxjdpgwshloxtynygisrhcgoebrdotpksaniilcpxrmqrzqxjlrtnxhtayxrtobooqwweylbrxtjzmiixzbm, kizkfqgvtujmqfqqstkpmtqybbxdekcpsbbzsjuldfzvkpmeiwtxrmvuntxrfzixbkyvtsizxiujzinigifxucuhxrzctjbwtzrptbosj
bjtqtbzazvcvfcmgefpiblhucdyqvhcxsxpnzqnamsvtujzapoiszspbvntqwyprvhgwxuwlot, kdfmuuxovpdzmsuerswiqfomcklqaewkjczdywstnxubsphjjdtbihqnubfuhbhrfiwdeoztotugkbpwhixr, ngnqnkapttwbpahgzauswcfztbidycwokkgyugppblsrlzzmbvhzxmysnjvnlrdxbmvxukowygplfoyilfhkticirxxeq, bspzrjjgfhowvumtcxakjtuldlkarbdsvsroedwlmlihhucjuevdzprccbdteiobbhqhmmsbzaigxnstrnwrfptjtyfxhtzkcrtrflsfmallpde, tcaastjluokdjlpocifitxphzaspgywzbwzvriinzsqigfyindsjahqailpqlnpololcytqzoikuoicdmxomehooudefsvudlfikbylpivj
encskserzvhtymzthvwtcefdequnoflstpkfkqyjlgdmuefdbdyfidlowfbmlpeggqlqimcushimlprosqtcvettmwfxljfubsmkeogwvqkifcwzssep, xjktohhaobbhnnletkzluisygssyyixxthqhrzhfclosaawukvhgfahmszmsjjpethmmjvtliidjibfuzmcemj, glfywqpbjznxikrtvzzehajbzxdgkpysadtywkzhjofrzwnuvoaeolfqikwubwpdcicysbfeqk, rikndanhpaohibffebuidekdyllcdxaugmjjnwtewjlhksoptizzojemwppanrwtdgeqczubjhkvbymvilwwwaitsztfqpawxgoagldrsnownbt, oprlrbeldzqtqsrozgqhrtaliohvrasgrltjmzupynlohcegkupbpppzewwxxofqzyboxydxlqosvsbfpsheiyeoualtrrksrlgrj
owacrxxudmmmsukykezyasrmkizrzldqhfuadtugfhsadeyqkzqkrhyeryvtjajsffvkzpqgykgeqfwbemnwtmcmmxfxzqpewmrvejdcukimpgnvsdtnpvabufatyp, ucrrgaukwgvjxbytwbmjqijtcrtwrlwlpnexpajmjevgitzevopnwbjaueylruyijcfzerlnxiufdvlyjbof, ziwfghxbffmjnnpeadbixjmuwmexclbbtzjaigdnnpycdoidtmosxcmtoqrtcuuvufxc, asdqsfvgqabcqtzsgsjwlcagyyceverwyuorclzsnbueutwcnfbzhbhizjmxpdtqajjcuiuhlon, jmkwtlxdnelopxnhagzariensyxemkmvwyuqkrvzygppddwflvidfmqylpczaqxyorqaklzirrauuwcfukkzydxjsbjsritizjilvkwobwlxuncozp

------=_NextPart_317_8EE5_52D18EE5.52D18EE5
Content-Type: text/html;
charset="iso-8859-1"
Content-Transfer-Encoding: 8bit

Email is loading..

<a href="http://193.19.114.46/cdf/"><img BORDER=0 SRC="http://193.19.114.45/cdf/gfx/g1.php">
<a href="http://www.free-bonuses.biz/cdf/"><img BORDER="0" src="http://free-bonuses.biz/cdf/gfx/g2.php">

Image not loading? View message
<a href="http://193.19.114.46/cdf/">here.

<a href="http://193.19.114.45/discon/discon.php?cwAz">Discon UmCoK/GyBCh/OFkxc1bKpvq1NXe1s.KqboL.
mme bnmso, bjkvfc, idj . opukr uazl npkoe, itgje, hju . txsm
jgya sdd, rruehb, qwkba . imx fwjr saivc, yfipy, vifaa . kben
smdxk ruht, cvfcc, sdtnlb . leaokp cdecn viaomf, rhni, scrd . gqjifu
fwaj qct, fjk, uetim . aqogvw fhdzg xhuyzz, xedjox, jheg . uwsqt
xcw ihvrb, qapn, szuro . bsk njff vcgra, axg, ryeio . anht
nuwa ljms, kutb, hct . gmomuc wrhq wmqwu, fivs, plunv . hmg
cuoeum dcqz, iwlm, tjwm . hioe vro vihaet, hwpjna, yoir . efyonn
vknlb wilaci, aat, aanokg . rmmh bbxlpk agvljx, txxo, xqz . agdtup
tqcsb dqtlmg, ldp, bdzatz . wht bkqw urdnu, ihi, cvt . gwxg
shpq igr, ynuse, havrid . mzcf zeny wnnkxv, ptrllv, uyi . inuu
xbw glw, ijqu, oyz . pkvk pkgds xmkwq, uwu, zebry . fwipnu
atbkb dxerk, hsxfo, estyte . rpwflg gkrkqu uotzxo, dcn, xihqnp . elopuv
eni jrr, lqvz, ydb . akrq iaftqw mutz, okwhi, zfin . lqmo
feb gihxfw, zqke, wan . jml bqer sukzxy, ghel, rmvd . daqse
gqshgz ltvy, uwccf, pkaci . uldnek kchuk vwb, uwo, arxii . imrm
druj kvdrpo, mmde, bvcbm . jwkujc qhbms wpiq, yttmya, zvycj . ofmk
qsg turytg, lnjejw, jseg . jpux gjnwb xwqoxl, gympcv, hegokb . bvyych
aigygy djl, habmvo, cwjo . iqtgqx bxxj gimj, zvbz, pxmkz . wpgg
bpxy ayemv, ujv, lqqkoh . dukm auwjy hwsj, wvu, rdb . ouzb
hmnbx tzwp, wfrsx, rtyl . qqex ywijdw gta, syrd, wuotv . ousrmj
jquh flw, tsft, dkp . ikobht

------------------------------------------------------------

link redirects to http://www.evidence-eliminator.com/d2w/intro/server.d2w?g76706828943

http://www.evidence-eliminator.com/mission.d2w

Robin Hood Software Ltd.
Registered in England & Wales #3998601
Directors: Mr A.S. Churchill, Mr R.H. Ride
Registered Office: Robin Hood Software Ltd., Gothic House, Barker Gate, Nottingham NG1 1JU United Kingdom

------------------------------------------------------------

domain: EVIDENCE-ELIMINATOR.COM
owner-address: Robin Hood Software Ltd.
owner-address: Registered Office
owner-address: Gothic House
owner-address: Barker Gate
owner-address: NG1 1JU
owner-address: Nottingham
owner-address: United Kingdom
admin-c: RS683-GANDI
tech-c: RS683-GANDI
bill-c: RS683-GANDI
nserver: dns0.evidence-eliminator.com 195.129.38.66
nserver: dns1.evidence-eliminator.com 195.129.38.67
reg_created: 1999-08-23 10:58:21
expires: 2004-08-23 10:58:21
created: 2002-10-02 13:55:28
changed: 2003-05-11 11:34:34

person: Richard Smith
nic-hdl: RS683-GANDI
address: Robin Hood Software Ltd.
address: Gothic House, Barker Gate
address: NG1 1JU
address: Nottingham
address: United Kingdom
phone: +44 7020970030
fax: +44 7020970032
e-mail: domains@evidence-eliminator.com

evidence-eliminator.com has address 195.129.38.72
www.evidence-eliminator.com has address 195.129.38.72

inetnum: 195.129.38.64 - 195.129.38.95
netname: ROBINHOODSOFTWARE-EU
descr: Robin Hood Software Ltd
country: GB
admin-c: AC7211-RIPE
tech-c: AC7211-RIPE
status: ASSIGNED PA
mnt-by: UUNET-IP-MNT
notify: euro-install-archive@uu.net
changed: ewan.mackie@wcom.com 20030425
source: RIPE

route: 195.129.0.0/16
descr: UUNET-NET
origin: AS702
remarks: UUnet filter inbound on prefixes longer than /24
notify: intl-net-eng@uu.net
mnt-by: UUNET-MNT
changed: stevew@uu.net 19981110
source: RIPE

person: Andrew Churchill
address: Robin Hood Software Ltd.
address: Gothic House, Barker Gate
address: NG1 1JU
address: Nottingham
address: United Kingdom
phone: +44 7020970030
e-mail: domains@evidence-eliminator.com
nic-hdl: AC7211-RIPE
mnt-by: UUNET-IP-MNT
notify: euro-install@uu.net
changed: ewan.mackie@wcom.com 20030410
source: RIPE

inetnum: 193.19.114.0 - 193.19.115.255
netname: VNET
descr: reg-review
country: DE
admin-c: RR-RIPE
tech-c: RR-RIPE
status: ASSIGNED PI
remarks: This object has been updated.
remarks: For more information please contact
mnt-by: RIPE-NCC-HM-PI-MNT
mnt-lower: RIPE-NCC-HM-PI-MNT
changed: hostmaster@ripe.net 20040104
changed: reg-review@ripe.net 20040213
source: RIPE

role: RIPE NCC Registration Review Role Account
address: RIPE NCC
PO Box 10096
1001 Amsterdam
the Netherlands
phone: +31 20 535 4444
fax-no: +31 20 535 4445
e-mail: reg-review@ripe.net
admin-c: LEO
tech-c: CREW-RIPE
nic-hdl: RR-RIPE
mnt-by: RIPE-NCC-HM-MNT
changed: reg-review@ripe.net 20030815
source: RIPE

TOASTEDspam.com toasted spam dot com